Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 29 showing 561 ~ 580 out of 742,877 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection
  • RRID:Addgene_104215

    This resource has 1+ mentions.

http://www.addgene.org/104215

Species: Homo sapiens
Genetic Insert: WWP2 WW domain #4
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - QEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFE

Proper citation: RRID:Addgene_104215 Copy   


  • RRID:Addgene_104214

    This resource has 1+ mentions.

http://www.addgene.org/104214

Species: Homo sapiens
Genetic Insert: WWP2 WW domain #3
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMI

Proper citation: RRID:Addgene_104214 Copy   


  • RRID:Addgene_104335

http://www.addgene.org/104335

Species: Escherichia coli str. K-12 substr. MG1655
Genetic Insert: OmpR
Vector Backbone Description: Vector Backbone:ColE1; Vector Types:Bacterial Expression; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:29650958

Proper citation: RRID:Addgene_104335 Copy   


http://www.addgene.org/104270

Species: Homo sapiens
Genetic Insert: DRP2 WW domain
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - LSSSVQVPWERAISPNKVPYYINHQAQTTCWDHPKMTEL

Proper citation: RRID:Addgene_104270 Copy   


http://www.addgene.org/104266

Species: Homo sapiens
Genetic Insert: BAG3 WW domain
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - DRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPS

Proper citation: RRID:Addgene_104266 Copy   


http://www.addgene.org/104300

Species: Homo sapiens
Genetic Insert: CEP164 WW domain
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - AAPGEWKPCQDITGDIYYFNFAHGQSMWDHPCDAAA

Proper citation: RRID:Addgene_104300 Copy   


http://www.addgene.org/104264

Species: Homo sapiens
Genetic Insert: FNBP4 WW domain #2
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - EINATPKGWSCHWDRDHRRYFYVNEQSGESQWEFPDGEE

Proper citation: RRID:Addgene_104264 Copy   


  • RRID:Addgene_104307

http://www.addgene.org/104307

Species: Other
Genetic Insert: LifeAct-mGarnet
Vector Backbone Description: Backbone Marker:Invitrogen/ life technologies; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26648024

Proper citation: RRID:Addgene_104307 Copy   


  • RRID:Addgene_104306

http://www.addgene.org/104306

Species: Homo sapiens
Genetic Insert: YAP WW1 domain
Vector Backbone Description: Backbone Marker:Pharmacia; Vector Backbone:pGEX-2TK; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: The human WW domain in this plasmid was obtained from cDNA described in the following reference: Sudol M et al. J Biol Chem. 1995 Jun 16;270(24):14733-41. https://www.ncbi.nlm.nih.gov/pubmed/7782338 Please see the following references for additional information regarding the WW domain of human YAP: 1. Chen HI and Sudol M. Proc Natl Acad Sci U S A. 1995 Aug 15;92(17):7819-23. https://www.ncbi.nlm.nih.gov/pubmed/7644498 2. Toepert F et al., Angew Chem Int Ed Engl. 2001 Mar 2;40(5):897-900. https://www.ncbi.nlm.nih.gov/pubmed/11241639

Proper citation: RRID:Addgene_104306 Copy   


  • RRID:Addgene_104309

    This resource has 1+ mentions.

http://www.addgene.org/104309

Species: Other
Genetic Insert: mito-mGarnet
Vector Backbone Description: Backbone Marker:Invitrogen/ life technologies; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26648024

Proper citation: RRID:Addgene_104309 Copy   


  • RRID:Addgene_104308

http://www.addgene.org/104308

Species: Other
Genetic Insert: LifeAct-mGarnet2
Vector Backbone Description: Backbone Marker:Invitrogen/ life technologies; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28044150

Proper citation: RRID:Addgene_104308 Copy   


http://www.addgene.org/104269

Species: Homo sapiens
Genetic Insert: PIN1L WW domain
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - DEEKLPPGWEKRMSRPSGRGYYFNHITNPSQWERPSGNS

Proper citation: RRID:Addgene_104269 Copy   


http://www.addgene.org/104281

Species: Homo sapiens
Genetic Insert: TCERG1L WW domain #2
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - STPVPGSPWCVVWTGDDRVFFFNPTMHLSVWEKPMDLKD

Proper citation: RRID:Addgene_104281 Copy   


http://www.addgene.org/104277

Species: Homo sapiens
Genetic Insert: KIAA1688 WW domain #1
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PGSNTRLEWVEIIEPRTRERMYANLVTGECVWDPPAGVR

Proper citation: RRID:Addgene_104277 Copy   


http://www.addgene.org/104279

Species: Homo sapiens
Genetic Insert: IQGAP1 WW domain
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - AVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQ

Proper citation: RRID:Addgene_104279 Copy   


http://www.addgene.org/104278

Species: Homo sapiens
Genetic Insert: KIAA1688 WW domain #2
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - KRTSENQWWELFDPNTSRFYYYNASTQRTVWHRPQGCDI

Proper citation: RRID:Addgene_104278 Copy   


  • RRID:Addgene_104311

http://www.addgene.org/104311

Species: Other
Genetic Insert: H2B-mGarnet
Vector Backbone Description: Backbone Marker:Invitrogen/ life technologies; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26648024

Proper citation: RRID:Addgene_104311 Copy   


http://www.addgene.org/104274

Species: Homo sapiens
Genetic Insert: ARHGAP12 WW domain #1
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PAIQINGEWETHKDSSGRCYYYNRGTQERTWKPPRWTRD

Proper citation: RRID:Addgene_104274 Copy   


http://www.addgene.org/104315

Species: Other
Genetic Insert: alpha-actinin-mGarnet
Vector Backbone Description: Backbone Marker:Invitrogen/ life technologies; Backbone Size:5428; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26648024

Proper citation: RRID:Addgene_104315 Copy   


http://www.addgene.org/104243

Species: Homo sapiens
Genetic Insert: MAGI1 WW domain #2
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - SELELPAGWEKIEDPVYGIYYVDHINRKTQYENPVLEAK

Proper citation: RRID:Addgene_104243 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. Type 1 Diabetes Research Networks Resources

    Welcome to the T1D Resources search. From here you can search through a compilation of resources used by T1D and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that T1D has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on T1D then you can log in from here to get additional features in T1D such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into T1D you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within T1D that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X