Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
T7-U4 Resource Report Resource Website |
RRID:Addgene_111336 | snR14 | Saccharomyces cerevisiae | Ampicillin | PMID:7585243 | for in vitro transcription from T7 promoter | Vector Backbone:pUC19; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-09-12 02:15:10 | 0 | |
|
pGEX-Cwc25-GST Resource Report Resource Website |
RRID:Addgene_111339 | CWC25 | Saccharomyces cerevisiae | Ampicillin | Vector Backbone:pGEX; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-09-12 02:15:10 | 0 | |||
|
PSUPER-344(hPot1) Resource Report Resource Website 1+ mentions |
RRID:Addgene_11133 | RNAi against human Protection of Telomeres 1 | Homo sapiens | Ampicillin | PMID:15620654 | Target sequence is: TACCT CGCAC TTCAA GCAA. | Backbone Size:3200; Vector Backbone:PSUPER; Vector Types:Mammalian Expression, RNAi; Bacterial Resistance:Ampicillin | N/A | 2026-09-12 02:15:10 | 1 |
|
Prp39-pET21b Resource Report Resource Website |
RRID:Addgene_111286 | PRP39 | Saccharomyces cerevisiae | Ampicillin | PMID:24231520 | Backbone Marker:EMD Biosciences; Backbone Size:5442; Vector Backbone:pET21b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-09-12 02:15:10 | 0 | ||
|
PSUPER-1660s(hPot1) Resource Report Resource Website |
RRID:Addgene_11132 | RNAi vector for human protection of telomeres 1(control for 1660) | Homo sapiens | Ampicillin | PMID:15620654 | Plasmid contains the 1660 sequence (GTACT AGAAG CCTAT CTCA), but is not a hairpin. | Backbone Size:3200; Vector Backbone:PSUPER; Vector Types:Mammalian Expression, RNAi; Bacterial Resistance:Ampicillin | N/A | 2026-09-12 02:15:10 | 0 |
|
PSUPER-344s(hPot1) Resource Report Resource Website |
RRID:Addgene_11134 | RNAi vector for human protection of telomeres 1(control for 344) | Homo sapiens | Ampicillin | PMID:15620654 | Plasmid contains the 344 sequence (TACCT CGCAC TTCAA GCAA), but is not a hairpin. | Backbone Size:3200; Vector Backbone:PSUPER; Vector Types:Mammalian Expression, RNAi; Bacterial Resistance:Ampicillin | N/A | 2026-09-12 02:15:10 | 0 |
|
puC19 preACT1(WT) Resource Report Resource Website |
RRID:Addgene_111323 | ACT1 | Saccharomyces cerevisiae | Ampicillin | PMID:16103217 | for use in in vitro splicing reactions | Vector Backbone:pUC19; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-09-12 02:15:10 | 0 | |
|
Prp40-pET21b Resource Report Resource Website 1+ mentions |
RRID:Addgene_111287 | PRP40 | Saccharomyces cerevisiae | Ampicillin | PMID:24231520 | Backbone Marker:EMD Biosciences; Backbone Size:5442; Vector Backbone:pET21b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2026-09-12 02:15:10 | 1 | ||
|
HsCLYBL(aa23-340)-His Resource Report Resource Website |
RRID:Addgene_111288 | human CLYBL ( aa23-340) codon optimized for bacterial expression | Homo sapiens | Kanamycin | PMID:29056341 | Backbone Size:5400; Vector Backbone:pET30a; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-09-12 02:15:10 | 0 | ||
|
pbabe-c-mycT58A+HRasG12V Resource Report Resource Website 1+ mentions |
RRID:Addgene_11130 | c-myc, HRas | Homo sapiens | Ampicillin | PMID:16267004 | Contains mouse c-myc and human Hras. This plasmid was generated by cloning c-MycT58A cDNA with flanking BamHI-EcoRI restriction sites added by PCR into the same sites of the polylinker of pBABEpuro or pBABEblast and by excising the selectable marker from the HindIII/ClaI sites and ligating into the same site H-RasG12V cDNA in which HindIII/ClaI sites were again added by PCR. | Backbone Size:4500; Vector Backbone:pbabe; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin | c-myc T58A, A156T, and G438R; and H-Ras G12V | 2026-09-12 02:15:10 | 6 |
|
pRS314 snu114-del(IV) Resource Report Resource Website |
RRID:Addgene_111321 | SNU114 | Saccharomyces cerevisiae | Ampicillin | PMID:15911574 | Backbone Size:4783; Vector Backbone:pRS314; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin | deletion of domain IVa | 2026-09-12 02:15:10 | 0 | |
|
puC19 preACT1(BrG) Resource Report Resource Website |
RRID:Addgene_111326 | ACT1 | Saccharomyces cerevisiae | Ampicillin | PMID:16103217 | for use in in vitro splicing reactions | Vector Backbone:pUC19; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | branch site A to G mutation in intron | 2026-09-12 02:15:10 | 0 |
|
puC19 preACT1(BrC) Resource Report Resource Website |
RRID:Addgene_111325 | ACT1 | Saccharomyces cerevisiae | Ampicillin | PMID:16103217 | for use in in vitro splicing reactions | Vector Backbone:pUC19; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | branch site A to C mutation in intron | 2026-09-12 02:15:10 | 0 |
|
pET-30a(+)-N-SH2 Resource Report Resource Website 1+ mentions |
RRID:Addgene_111274 | murine Syk (N)SH2 domain (Ser 8 to Gly 117), with an N-terminal (His)6 tag and TEV cleavage site | Mus musculus | Kanamycin | PMID:26468009 | encoding the following protein sequence: MHHHHHHENLYFQGSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTG | Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | 2026-09-12 02:15:10 | 1 | |
|
pET-30a(+)-Syk-tSH2-FX Resource Report Resource Website 1+ mentions |
RRID:Addgene_111272 | murine Syk tandem SH2 domains (Ser 8 to Gln 264), with interdomain A (Phe 119 to His 162) substituted by a flexible 20aa linker | Mus musculus | Kanamycin | PMID:26468009 | encoding the following protein sequence: MSANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELNGTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPGGSGGSGGSGSGGSGGSGGSEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQ | Backbone Marker:Novagen; Backbone Size:5422; Vector Backbone:pET-30a(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin | interdomain A (Phe 119 to His 162) substituted by a flexible 20-amino-acid linker (GGS)3GS(GGS)3 | 2026-09-12 02:15:10 | 1 |
|
pRS314 snu114-14 Resource Report Resource Website |
RRID:Addgene_111311 | SNU114 | Saccharomyces cerevisiae | Ampicillin | PMID:15911574 | Backbone Size:4783; Vector Backbone:pRS314; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin | snu114-14 | 2026-09-12 02:15:10 | 0 | |
|
pRS314 snu114-50 Resource Report Resource Website |
RRID:Addgene_111315 | SNU114 | Saccharomyces cerevisiae | Ampicillin | PMID:15911574 | There is an additional mutation in snu114 E910G- Not sure if this affects plasmid function. | Backbone Size:4783; Vector Backbone:pRS314; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin | snu114-50 (C928R) | 2026-09-12 02:15:10 | 0 |
|
pRS314 snu114-60 Resource Report Resource Website |
RRID:Addgene_111316 | SNU114 | Saccharomyces cerevisiae | Ampicillin | PMID:15911574 | Backbone Size:4783; Vector Backbone:pRS314; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin | snu114-60 (K939stop) | 2026-09-12 02:15:10 | 0 | |
|
pRS314 snu114-40 Resource Report Resource Website |
RRID:Addgene_111314 | SNU114 | Saccharomyces cerevisiae | Ampicillin | PMID:15911574 | Backbone Size:4783; Vector Backbone:pRS314; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin | snu114-40 (M842R) | 2026-09-12 02:15:10 | 0 | |
|
pRS314 myc-SNU114 Resource Report Resource Website |
RRID:Addgene_111317 | SNU114 | Saccharomyces cerevisiae | Ampicillin | PMID:15911574 | A single myc epitope was placed immediately after the start codon of SNU114 by inserting the annealed oligos oKD140 (5′-AATTCCCAGAACAAAAATTGATTTCTGAAGAAGATTTGAATA-3′) and oKD141 (5′-GATCTATTCAAATCTTCTTCAGAAATCAATTTTTGTTCTGGG-3′), which have overhanging EcoRI/BglII sites, into the same sites of pTB4. The resulting plasmid was named pTB19. | Backbone Size:4783; Vector Backbone:pRS314; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin | 2026-09-12 02:15:10 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the T1D Resources search. From here you can search through a compilation of resources used by T1D and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that T1D has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on T1D then you can log in from here to get additional features in T1D such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into T1D you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
